PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy016226
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 533aa    MW: 59798.7 Da    PI: 5.8481
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59544348PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3235.8e-991184673346
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                + Ll++A+a++++++++ q+l++ l+el+sp+gd+ q+laayf++AL +r+++ +++++++l++ ++++ + +++ + +  f+evsP+ +f+h++aN aI
  Ahy016226 118 DILLDAARALADKNTARLQHLMWMLNELSSPYGDTEQKLAAYFLQALFSRMTHAGDRTFRTLTSASDKTCSFESTRKTVLKFQEVSPWTTFGHVAANGAI 217
                689*********************************************************998888876554444455555******************* PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......skeeleetgerLakfAeelgvpfefnvlvak.rledleleeLr 195
                lea+ege+++Hi+D++ ++++QWp+L++aLa+R++++p+lR+T+v+  +++       ++ ++e+g r++kfA+ +gvpf+fnv++++ +l+++++ eL+
  Ahy016226 218 LEALEGETKLHIVDISNTYCTQWPTLFEALATRSDDTPHLRLTTVVVTTAHggsvpaAQRVMKEIGARMEKFARLMGVPFKFNVVHHSgDLSQFDFGELD 317
                *********************************************9998889***99999*************************8888*********** PP

       GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse....sFlerflealeyysalfdsleaklpreseerikvErellg 291
                ++ +EalaVn+v +lh++     ++ ++rd+v++ +++l+P++v+vve+ead++ +    +F+++f e+l+++ + f++le+++pr+s+er ++Er+  g
  Ahy016226 318 IRDDEALAVNCVNSLHSIA----AVGNRRDAVISSLRRLQPRIVTVVEEEADLDVGlegfEFVKGFQECLRWFRVYFEALEESFPRTSNERLMLERA-AG 412
                ******************8....888899*********************99865556679************************************.** PP

       GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                r+ v++vac+ +e+ er+et+++W++r++ +GF+++++se++ +++++  ++v++
  Ahy016226 413 RAMVDLVACSAEESSERRETAARWSQRMHGSGFNTASFSEEVCDDVRAAAEEVQG 467
                **********************************************999988874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.27390475IPR005202Transcription factor GRAS
PfamPF035142.0E-96118467IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MDTLFRVVSF EEYQQQQQVE LDQSLNSTTT TTTSSSSRSS RHNYHHYQQQ QQDEECFNFF  60
MDEEDLSSSS SKHHYYPYHS QSHPHTSTPT ATILTPNDFS HSFDFNLQFS SNTKWATDIL  120
LDAARALADK NTARLQHLMW MLNELSSPYG DTEQKLAAYF LQALFSRMTH AGDRTFRTLT  180
SASDKTCSFE STRKTVLKFQ EVSPWTTFGH VAANGAILEA LEGETKLHIV DISNTYCTQW  240
PTLFEALATR SDDTPHLRLT TVVVTTAHGG SVPAAQRVMK EIGARMEKFA RLMGVPFKFN  300
VVHHSGDLSQ FDFGELDIRD DEALAVNCVN SLHSIAAVGN RRDAVISSLR RLQPRIVTVV  360
EEEADLDVGL EGFEFVKGFQ ECLRWFRVYF EALEESFPRT SNERLMLERA AGRAMVDLVA  420
CSAEESSERR ETAARWSQRM HGSGFNTASF SEEVCDDVRA AAEEVQGRVV NGTVLGSRRN  480
DAVVEGAGGG VGQCMEAQLH VVLIDHHSLL LARGFSFLVR FGSVRLRWVG LGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2615045137329GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016201630.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLI1J9E70.0I1J9E7_SOYBN; Uncharacterized protein
STRINGGLYMA01G40180.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-174GRAS family protein